Hematopoietic Prostaglandin D Synthase/HPGDS Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HPGDS. Source: E. coli
Amino Acid Sequence: KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HPGDS |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83322. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Hematopoietic Prostaglandin D Synthase/HPGDS Recombinant Protein Antigen
Background
Prostaglandin D synthase catalyzes the isomerization of PGH2 to produce PGD2. Prostaglandin D synthase induces sleep, regulates nociception, inhibits platelet aggregation, and acts as an allergic mediator. Two distinct types of PGD synthase have been identified, namely the lipocalin type enzyme (b-trace) and the hematopoietic enzyme. Lipocalin type prostaglandin D synthase is localized in the central nervous system and male genital organs of various mammals and the human heart. This enzyme has been identified as b-trace, which is a major protein in human cerebrospinal fluid. Hematopoietic prostaglandin D synthase is widely distributed in the peripheral tissues and is localized in the antigen-presenting cells, mast cells, and megakaryocytes. This enzyme, which requires glutathione for activity, belongs to the sigma-class of glutathione-S-transferases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Bv, Eq, Fe, Fi, Hu, Mu, Po, Pm, Rb, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Gp, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Publications for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP) (0)
There are no publications for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP) (0)
There are no reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP) (0)
Additional Hematopoietic Prostaglandin D Synthase/HPGDS Products
Research Areas for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP)
Find related products by research area.
|
Blogs on Hematopoietic Prostaglandin D Synthase/HPGDS