Hematopoietic Prostaglandin D Synthase/HPGDS Recombinant Protein Antigen

Images

 
There are currently no images for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Hematopoietic Prostaglandin D Synthase/HPGDS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HPGDS.

Source: E. coli

Amino Acid Sequence: KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HPGDS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83322.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hematopoietic Prostaglandin D Synthase/HPGDS Recombinant Protein Antigen

  • EC 2.5.1.18
  • EC 5.3.99.2
  • glutathione S-transferase sigma
  • Glutathione S-transferase
  • Glutathione-dependent PGD synthase
  • Glutathione-requiring prostaglandin D synthase
  • GST class-sigma
  • GSTS
  • GSTShematopoietic prostaglandin D2 synthase
  • hematopoietic prostaglandin D synthase
  • HPGDS
  • H-PGDS
  • PGDS
  • PGDSglutathione-dependent PGD synthetase
  • Prostaglandin-H2 D-isomerase
  • PTGDS2

Background

Prostaglandin D synthase catalyzes the isomerization of PGH2 to produce PGD2. Prostaglandin D synthase induces sleep, regulates nociception, inhibits platelet aggregation, and acts as an allergic mediator. Two distinct types of PGD synthase have been identified, namely the lipocalin type enzyme (b-trace) and the hematopoietic enzyme. Lipocalin type prostaglandin D synthase is localized in the central nervous system and male genital organs of various mammals and the human heart. This enzyme has been identified as b-trace, which is a major protein in human cerebrospinal fluid. Hematopoietic prostaglandin D synthase is widely distributed in the peripheral tissues and is localized in the antigen-presenting cells, mast cells, and megakaryocytes. This enzyme, which requires glutathione for activity, belongs to the sigma-class of glutathione-S-transferases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-31589
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-79280
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP1-76755
Species: Gp, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB9080
Species: Hu
Applications: WB

Publications for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP) (0)

There are no publications for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP) (0)

There are no reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hematopoietic Prostaglandin D Synthase/HPGDS Products

Research Areas for Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP)

Find related products by research area.

Blogs on Hematopoietic Prostaglandin D Synthase/HPGDS

There are no specific blogs for Hematopoietic Prostaglandin D Synthase/HPGDS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hematopoietic Prostaglandin D Synthase/HPGDS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HPGDS