HECW1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HECW1 Antibody [NBP1-93645] - Staining of human pancreas shows strong nuclear and cytoplasmic positivity in exocrine glandular cells and islet cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HECW1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HECW1 Antibody - BSA Free (NBP1-93645) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STEPESAQIQDSPMNNLMESGSGEPRSEAPESSESWKPEQLGEGSVPDGPGNQSIELSRPAEEAAVITEAGDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDGEAPAS
• Localization: Nucleus
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HECW1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HECW1 Protein (NBP1-93645PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HECW1 Antibody - BSA Free

• C2 and WW domain-containing protein 1
• HECT type E3 ubiquitin ligase
• HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1
• NEDD4-like E3 ubiquitin-protein ligase 1
• NEDL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for HECW1 Antibody (NBP1-93645). (Showing 1 - 1 of 1 FAQ).

1. What is the difference between your two antibodies for HECW1, product numbers NBP1-93644 and NBP1-93645? Can I use any of them for WB?
   • Both of these antibodies have been tested in IF and IHC-P. The difference between the two is that they are made to different sequences from the protein. You can see the specific sequences on the datasheet for each product. We have not tested either one for WB, however if you wanted to try one for WB and share your data, you can participate in our Innovator's Reward Program. More information can be found at Innovator's Reward Program.

Bioinformatics

• Gene Symbol: HECW1
• Entrez:
  • 23072(Human)
• Uniprot:
  • Q76N89(Human)