HEBP1 Recombinant Protein Antigen

Images

 
There are currently no images for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HEBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEBP1.

Source: E.coli

Amino Acid Sequence: EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
HEBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57944 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HEBP1 Recombinant Protein Antigen

  • HBPHEBP
  • heme binding protein 1
  • heme-binding protein 1
  • p22HBP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: WB, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
7270-IL/CF
Species: Hu
AF7974
Species: Mu
Applications: WB
NBP2-37550
Species: Hu
Applications: WB, ELISA, Flow, IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP) (0)

There are no publications for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP) (0)

There are no reviews for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HEBP1 Products

Bioinformatics Tool for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP)

Discover related pathways, diseases and genes to HEBP1 Recombinant Protein Antigen (NBP2-57944PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP)

Discover more about diseases related to HEBP1 Recombinant Protein Antigen (NBP2-57944PEP).

PTMs for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP)

Learn more about PTMs related to HEBP1 Recombinant Protein Antigen (NBP2-57944PEP).

Blogs on HEBP1

There are no specific blogs for HEBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF
HEBP1 Antibody
NBP2-14977
HEBP1 Antibody
NBP2-14977
HEBP1 Antibody
NBP2-14977

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HEBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HEBP1