HEBP1 Recombinant Protein Antigen

Images

 
There are currently no images for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HEBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEBP1.

Source: E. coli

Amino Acid Sequence: EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HEBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57944.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HEBP1 Recombinant Protein Antigen

  • HBPHEBP
  • heme binding protein 1
  • heme-binding protein 1
  • p22HBP

Background

HEBP1, also known as Heme-binding protein 1, is a 189 amino acid that is approx. 21 kDa, contains a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and stimulates calcium mobilization and chemotaxis in monocytes and dendritic cells; capable of binding free porphyrinogens and thus facilitates removal of these potentially toxic compound; heme or porphyrins; metalloporphyrins, free porphyrins and N-methylprotoporphyrin. Disease research has been performed on the relationship of this protein to ankylosis, root resorption, dental enamel hypoplasia, rickets, and breast cancer. The protein has been linked to the GPCR downstream signaling, peptide ligand-binding receptors, formyl peptide receptors bind formyl peptides and many other ligands, signal transduction, and signaling by GPCR pathways where interacts with over 100 proteins including GOT1, KCNMA1, FPR1, FPR2, and FPR3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: IP, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF7974
Species: Mu
Applications: WB
NBP2-37550
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP) (0)

There are no publications for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP) (0)

There are no reviews for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HEBP1 Recombinant Protein Antigen (NBP2-57944PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HEBP1 Products

Blogs on HEBP1

There are no specific blogs for HEBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HEBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HEBP1