HAPLN2 Antibody - BSA Free

Western Blot: HAPLN2 Antibody [NBP2-87555] - WB Suggested Anti-HPLN2 antibody Titration: 1 ug/mL. Sample Type: Human U937 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HAPLN2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HAPLN2 Antibody - BSA Free (NBP2-87555) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAPLN2. Peptide sequence: YQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAPLN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HAPLN2 Antibody - BSA Free

• Brain link protein 1
• brain link protein-1
• BRAL1
• HAPLN2
• hyaluronan and proteoglycan link protein 2

Background

The 340 amino acid long, 37 kDA hyaluronan and proteoglycan link protein 2 encoded by the HAPLN2 gene monitors binding of versication V2 to hyaluronic acid. This protein may be a participant in the formation of the hyaluronan-associated matrix in the central nervous system (CNS). This matrix encourages neuronal confuction and structural stabilization. HAPLN2 participates in PTEN pathway, MAPK signaling, UPA-UPAR pathway, and transendothelial migration of leukocytes. It has been researched regarding its role in rabies, schizophrenia, neuronitis, and malignant glioma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAPLN2