HADHB Recombinant Protein Antigen

Images

 
There are currently no images for HADHB Recombinant Protein Antigen (NBP2-56259PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HADHB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HADHB.

Source: E. coli

Amino Acid Sequence: LPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HADHB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56259.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HADHB Recombinant Protein Antigen

  • 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit
  • 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein
  • acetyl-CoA acyltransferase
  • beta subunit
  • beta-ketothiolase
  • EC 2.3.1
  • EC 2.3.1.16
  • ECHB
  • hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit
  • hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit
  • hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
  • MGC87480
  • mitochondrial trifunctional enzyme, beta subunit
  • mitochondrial trifunctional protein, beta subunit
  • MTPB
  • TP-beta
  • trifunctional enzyme subunit beta, mitochondrial

Background

HADHB encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59947
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-83387
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91942
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85501
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47754
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-10437
Species: Hu
Applications: WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
NB100-53791
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85958
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02118
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13878
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74543
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

Publications for HADHB Recombinant Protein Antigen (NBP2-56259PEP) (0)

There are no publications for HADHB Recombinant Protein Antigen (NBP2-56259PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HADHB Recombinant Protein Antigen (NBP2-56259PEP) (0)

There are no reviews for HADHB Recombinant Protein Antigen (NBP2-56259PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HADHB Recombinant Protein Antigen (NBP2-56259PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HADHB Products

Blogs on HADHB

There are no specific blogs for HADHB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HADHB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HADHB