HACE1 Antibody - Azide and BSA Free

Western Blot: HACE1 Antibody [NBP3-03904] - Analysis of extracts of various cell lines, using HACE1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunohistochemistry-Paraffin: HACE1 Antibody [NBP3-03904] - Paraffin-embedded rat testis using HACE1 antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: HACE1 Antibody [NBP3-03904] - Paraffin-embedded human placenta using HACE1 antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HACE1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit HACE1 Antibody - Azide and BSA Free (NBP3-03904) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HACE1 (NP_065822.2). MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HACE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HACE1 Antibody - Azide and BSA Free

• E3 ubiquitin-protein ligase HACE1
• EC 6.3.2
• HACE
• HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
• HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1
• KIAA1320EC 6.3.2.-

Background

The HACE1 gene codes for a E3 ubiquitin-protein ligase HACE1 that is a participant in Golgi membrane fusion as well as in regulation of small GTPases to mediate ubiquitination and degradation of active RAC1, working in defense against pathogens. This protein may also play a role as a transcription regulator through its interaction with RARB. HACE1 exists in four isoforms: isoform 1 is 909 amino acids long, 102 kDA; isoform 2 is 318 amino acids long, 35 kDA; isoform 3 is 562 amino acids long, 63 kDA; isoform 4 is 694 amino acids long, nearly 78 kDA. HACE1 has been researched in regards to celiac disease, malaria, colorectal cancer, wilms tumors, and carcinoma. It is involved in the SMAD signaling network as well as ubiquitin-proteasome dependent proteolysis and has been known to interact with genes RARA, RAB4A, RAC1, PLXNA2, and IRF7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: HACE1