| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HA95/AKAP8L. Peptide sequence: NNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AKAP8L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HA95/AKAP8L Antibody (NBP2-87548)Find related products by research area.
|
|
HA95: Regulator of Nuclear Envelope Dynamics HA95 is a nuclear protein with high homology to the nuclear A-kinase anchoring protein AKAP95, involved in the regulation of nuclear envelope-chromatin interactions. Antibody immunostaining data indicate that HA95 is tightly associated with chromatin ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AKAP8L |