H1FOO Antibody - Azide and BSA Free

Western Blot: H1FOO Antibody [H00132243-B01P] - Analysis of H1FOO expression in transfected 293T cell line by H1FOO polyclonal antibody. Lane 1: H1FOO transfected lysate(22.77 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: H1FOO Antibody [H00132243-B01P] - Analysis of purified antibody to H1FOO on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

H1FOO Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse H1FOO Antibody - Azide and BSA Free (H00132243-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: H1FOO (AAH47943.1, 1 a.a. - 207 a.a.) full-length human protein. MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA
• Specificity: H1FOO,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: H1FOO
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for H1FOO Antibody - Azide and BSA Free

• H1 histone family, member O, oocyte-specific
• H1OO
• histone H1oo
• MGC50807
• Oocyte-specific histone H1
• Oocyte-specific linker histone H1
• osH1

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The protein encoded is a member of the histone H1 family. The related mouse gene is expressed only in oocytes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: H1FOO
• Entrez:
  • 132243(Human)
• Uniprot:
  • AAH47943.1(Human)