Guanylyl Cyclase beta 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Guanylyl Cyclase beta 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Guanylyl Cyclase beta 1
  
  

  Source: E.coli

  Amino Acid Sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GUCY1B1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24889It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Guanylyl Cyclase beta 1 Recombinant Protein Antigen

• EC 4.6.1.2
• GC-SB3
• GCS-beta-1
• GCS-beta-3
• guanylate cyclase 1, soluble, beta 3
• guanylate cyclase soluble subunit beta-1
• Guanylate cyclase soluble subunit beta-3
• GUC1B3GUCB3
• GUCSB3GC-S-beta-1
• GUCY1B1
• Soluble guanylate cyclase small subunit

Background

Guanylate Cyclase is an heterodimer of an alpha and a beta chain. Its enzymatic activity transforms GTP to GMP releasing a diphosphate. It binds 1 or 2 hemes per heterodimer. It is activated by nitric oxide in the presence of magnesium or manganese ions. There are two types of guanylate cyclase: soluble form and membrane-associated receptor form.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GUCY1B1