GTSE1 Antibody

Immunohistochemistry-Paraffin: GTSE1 Antibody [NBP2-32552] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Discontinued

GTSE1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IPASPSRTKIPAEKESHRDVLPDKPAPGAVNVPAAGSHLGQGKRAIPVPNKLGLKKTLLKAPGSTSNLARKSSSGPVWSGASSACTSPAVGKAKSSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTSE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GTSE1 Protein (NBP2-32552PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GTSE1 Antibody

• B99
• G2 and S phase-expressed protein 1
• G-2 and S-phase expressed 1
• GTSE-1
• Protein B99 homolog

Background

GTSE1 (G-2 and S-phase expressed 1) is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, GTSE1 accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTSE1