GTPBP9 Antibody

Images

 
Western Blot: GTPBP9 Antibody [NBP1-89725] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GTPBP9 Antibody [NBP1-89725] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & centrosome.
Immunohistochemistry-Paraffin: GTPBP9 Antibody [NBP1-89725] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Western Blot: GTPBP9 Antibody [NBP1-89725] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: GTPBP9 Antibody [NBP1-89725] - Staining of human cerebral cortex shows strong cytoplasmic as well as weaker nuclear positivity in neurons.
Immunohistochemistry-Paraffin: GTPBP9 Antibody [NBP1-89725] - Staining of human testis shows moderate cytoplasmic positivity as well as stronger nuclear immunoreactivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GTPBP9 Antibody [NBP1-89725] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTPBP9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTPBP9 Protein (NBP1-89725PEP)
Publications
Read Publication using NBP1-89725.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GTPBP9 Antibody

  • DKFZp313H1942
  • DNA damage-regulated overexpressed in cancer 45 protein
  • DOC45
  • EC 3.6.3
  • EC 3.6.3.-
  • GBP45
  • GTP-binding protein 9 (putative)
  • GTP-binding protein 9
  • GTP-binding protein PTD004
  • GTPBP9
  • homologous yeast-44.2 protein
  • Obg-like ATPase 1
  • PTD004

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88331
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF3014
Species: Hu
Applications: WB, IHC, Block
H00057180-B01P
Species: Hu
Applications: WB, ELISA
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89725
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GTPBP9 Antibody (NBP1-89725)(1)

Reviews for GTPBP9 Antibody (NBP1-89725) (0)

There are no reviews for GTPBP9 Antibody (NBP1-89725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTPBP9 Antibody (NBP1-89725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTPBP9 Products

Bioinformatics Tool for GTPBP9 Antibody (NBP1-89725)

Discover related pathways, diseases and genes to GTPBP9 Antibody (NBP1-89725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP9 Antibody (NBP1-89725)

Discover more about diseases related to GTPBP9 Antibody (NBP1-89725).
 

Pathways for GTPBP9 Antibody (NBP1-89725)

View related products by pathway.

Blogs on GTPBP9

There are no specific blogs for GTPBP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTPBP9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLA1