GTPBP9 Antibody - BSA Free

Staining of human cell line A-431 shows localization to cytosol & centrosome.

Immunohistochemistry-Paraffin: GTPBP9 Antibody [NBP1-89725] - Staining of human cerebral cortex shows strong cytoplasmic as well as weaker nuclear positivity in neurons.

Staining of human testis shows moderate cytoplasmic positivity as well as stronger nuclear immunoreactivity in a subset of cells in seminiferous ducts.

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Western Blot: GTPBP9 Antibody [NBP1-89725] - Analysis using Anti-OLA1 antibody NBP1-89725 (A) shows similar pattern to independent antibody NBP2-58957 (B).

Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-OLA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GTPBP9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GTPBP9 Antibody - BSA Free (NBP1-89725) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GTPBP9 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OLA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GTPBP9 Protein (NBP1-89725PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GTPBP9 Antibody - BSA Free

• DKFZp313H1942
• DNA damage-regulated overexpressed in cancer 45 protein
• DOC45
• EC 3.6.3
• EC 3.6.3.-
• GBP45
• GTP-binding protein 9 (putative)
• GTP-binding protein 9
• GTP-binding protein PTD004
• GTPBP9
• homologous yeast-44.2 protein
• Obg-like ATPase 1
• PTD004

Background

Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GTPBP9 Antibody (NBP1-89725)(1)

Publication using NBP1-89725

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: OLA1