Recombinant Human GTPBP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GTPBP3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 244 - 343 of Human GTPBP3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GTPBP3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GTPBP3 Protein

  • FLJ14700
  • FLJ17836
  • GTP binding protein 3 (mitochondrial)
  • GTPBG3
  • GTP-binding protein 3
  • MSS1
  • MTGP1Mitochondrial GTP-binding protein 1
  • THDF1
  • tRNA modification GTPase GTPBP3, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02316
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-85932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
AF6817
Species: Hu
Applications: WB
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for GTPBP3 Partial Recombinant Protein (H00084705-Q01) (0)

There are no publications for GTPBP3 Partial Recombinant Protein (H00084705-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTPBP3 Partial Recombinant Protein (H00084705-Q01) (0)

There are no reviews for GTPBP3 Partial Recombinant Protein (H00084705-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTPBP3 Partial Recombinant Protein (H00084705-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTPBP3 Products

Bioinformatics Tool for GTPBP3 Partial Recombinant Protein (H00084705-Q01)

Discover related pathways, diseases and genes to GTPBP3 Partial Recombinant Protein (H00084705-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP3 Partial Recombinant Protein (H00084705-Q01)

Discover more about diseases related to GTPBP3 Partial Recombinant Protein (H00084705-Q01).
 

Pathways for GTPBP3 Partial Recombinant Protein (H00084705-Q01)

View related products by pathway.

PTMs for GTPBP3 Partial Recombinant Protein (H00084705-Q01)

Learn more about PTMs related to GTPBP3 Partial Recombinant Protein (H00084705-Q01).

Blogs on GTPBP3

There are no specific blogs for GTPBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GTPBP3 Antibody
NBP1-91974
CD20 Antibody (AISB12)
NBP1-43435-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GTPBP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GTPBP3