We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GTF3A Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related GTF3A Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-89064PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GTF3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF3A.

Source: E. coli

Amino Acid Sequence: KRKDYLKQHMKTHAPERDVCRCPREGCGRTYTTVFNLQSHILSFHEESRPFVCEHAGCGKTFAMKQSLTRHAVVHDPDKKKMKLKVKKSREKRSLASHLSGYIPPKRKQGQGLSLCQNGESPNCVEDKMLSTV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89064.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF3A Recombinant Protein Antigen

  • general transcription factor IIIA
  • TFIIIAAP2
  • transcription factor IIIA

Background

The GTF3A gene encodes a zinc finger protein with nine Cis(2)-His(2) domains that interacts with the internal control region (ICR) of approximately 50 bases within 5S RNA genes. This is where it works as a RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The proteins coded by the GTF3A gene also play a role in regulating the stability of transcription of other genes. The GTF3A gene exists in two isoforms: isoform 1 is 365 amino acids long at 41 kDA while isoform 2 is 340 amino acids long at 38 kDA. GTF3A has been investigated in its role in apnea, glaucoma, digeorge syndrome, acute liver failure, and endocarditis. GTF3A participates in RNA polymerase III transcription and interacts with genes ABL1, FYN, CXCR2, GTF3C2, and EPN1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NBP1-31113
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-16366
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
DLP00
Species: Hu
Applications: ELISA
NBP1-84999
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88057
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB

Publications for GTF3A Protein (NBP1-89064PEP) (0)

There are no publications for GTF3A Protein (NBP1-89064PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF3A Protein (NBP1-89064PEP) (0)

There are no reviews for GTF3A Protein (NBP1-89064PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF3A Protein (NBP1-89064PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF3A Products

Array NBP1-89064PEP

Blogs on GTF3A

There are no specific blogs for GTF3A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3A