GTF3A Antibody [Biotin] Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GTF3A (NP_002088.2).
Sequence: MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPFVCDYEGCGKAFIRDYHLSRHILTHTGEKPF |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GTF3A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for GTF3A Antibody [Biotin]
Background
The GTF3A gene encodes a zinc finger protein with nine Cis(2)-His(2) domains that interacts with the internal control region (ICR) of approximately 50 bases within 5S RNA genes. This is where it works as a RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The proteins coded by the GTF3A gene also play a role in regulating the stability of transcription of other genes. The GTF3A gene exists in two isoforms: isoform 1 is 365 amino acids long at 41 kDA while isoform 2 is 340 amino acids long at 38 kDA. GTF3A has been investigated in its role in apnea, glaucoma, digeorge syndrome, acute liver failure, and endocarditis. GTF3A participates in RNA polymerase III transcription and interacts with genes ABL1, FYN, CXCR2, GTF3C2, and EPN1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Publications for GTF3A Antibody (NBP3-38541B) (0)
There are no publications for GTF3A Antibody (NBP3-38541B).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GTF3A Antibody (NBP3-38541B) (0)
There are no reviews for GTF3A Antibody (NBP3-38541B).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GTF3A Antibody (NBP3-38541B) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GTF3A Products
Blogs on GTF3A