GTF2H4 Antibody

Immunocytochemistry/Immunofluorescence: GTF2H4 Antibody [NBP2-57537] - Staining of human cell line U-2 OS shows localization to nuclear speckles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GTF2H4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTF2H4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GTF2H4 Recombinant Protein Antigen (NBP2-57537PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GTF2H4 Antibody

• Basic transcription factor 2 52 kDa subunit
• BTF2 p52
• General transcription factor IIH polypeptide 4
• general transcription factor IIH subunit 4
• general transcription factor IIH, polypeptide 4 (52kD subunit)
• general transcription factor IIH, polypeptide 4, 52kDa
• TFB2
• TFIIH basal transcription factor complex p52 subunit
• TFIIH

Background

GTF2H4 is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNAand, when complexed to CAK, in RNA transcription by RNA polymerase II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF2H4