GTF2H4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GTF2H4 Antibody [NBP2-57537] - Staining of human cell line U-2 OS shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF2H4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Specificity
Specificity of human GTF2H4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2H4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GTF2H4 Antibody

  • Basic transcription factor 2 52 kDa subunit
  • BTF2 p52
  • General transcription factor IIH polypeptide 4
  • general transcription factor IIH subunit 4
  • general transcription factor IIH, polypeptide 4 (52kD subunit)
  • general transcription factor IIH, polypeptide 4, 52kDa
  • TFB2
  • TFIIH basal transcription factor complex p52 subunit
  • TFIIH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91499
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
H00027044-Q01
Species: Hu
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-61060
Species: Hu, Mu
Applications: WB, ChIP, IP
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67850
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for GTF2H4 Antibody (NBP2-57537) (0)

There are no publications for GTF2H4 Antibody (NBP2-57537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H4 Antibody (NBP2-57537) (0)

There are no reviews for GTF2H4 Antibody (NBP2-57537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GTF2H4 Antibody (NBP2-57537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GTF2H4 Products

Bioinformatics Tool for GTF2H4 Antibody (NBP2-57537)

Discover related pathways, diseases and genes to GTF2H4 Antibody (NBP2-57537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H4 Antibody (NBP2-57537)

Discover more about diseases related to GTF2H4 Antibody (NBP2-57537).
 

Pathways for GTF2H4 Antibody (NBP2-57537)

View related products by pathway.

Research Areas for GTF2H4 Antibody (NBP2-57537)

Find related products by research area.

Blogs on GTF2H4

There are no specific blogs for GTF2H4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2H4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H4