GTF2H2 Antibody

Images

 
Western Blot: GTF2H2 Antibody [NBP2-56841] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GTF2H2 Antibody [NBP2-56841] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF2H2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Specificity
Specificity of human GTF2H2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2H2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GTF2H2 Antibody

  • Basic transcription factor 2 44 kDa subunit
  • BTF2 p44
  • BTF2
  • BTF2P44TFIIH basal transcription factor complex p44 subunit
  • General transcription factor IIH polypeptide 2
  • general transcription factor IIH subunit 2
  • general transcription factor IIH, polypeptide 2 (44kD subunit)
  • general transcription factor IIH, polypeptide 2, 44kD subunit
  • general transcription factor IIH, polypeptide 2, 44kDa
  • MGC102806
  • T-BTF2P44
  • TFIIH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
H00008814-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
MAB4640
Species: Hu
Applications: WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for GTF2H2 Antibody (NBP2-56841) (0)

There are no publications for GTF2H2 Antibody (NBP2-56841).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H2 Antibody (NBP2-56841) (0)

There are no reviews for GTF2H2 Antibody (NBP2-56841). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTF2H2 Antibody (NBP2-56841) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GTF2H2 Products

Bioinformatics Tool for GTF2H2 Antibody (NBP2-56841)

Discover related pathways, diseases and genes to GTF2H2 Antibody (NBP2-56841). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H2 Antibody (NBP2-56841)

Discover more about diseases related to GTF2H2 Antibody (NBP2-56841).
 

Pathways for GTF2H2 Antibody (NBP2-56841)

View related products by pathway.

Research Areas for GTF2H2 Antibody (NBP2-56841)

Find related products by research area.

Blogs on GTF2H2

There are no specific blogs for GTF2H2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H2