GSTO2 Antibody - BSA Free

Immunohistochemistry: GSTO2 Antibody [NBP3-38184] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using GSTO2 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Western Blot: GSTO2 Antibody [NBP3-38184] - Western blot analysis of various lysates using GSTO2 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Negative control (NC): MOLT-4.Exposure time: 90s.

Immunohistochemistry: GSTO2 Antibody [NBP3-38184] - Immunohistochemistry analysis of GSTO2 in paraffin-embedded Human testis tissue using GSTO2 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Western Blot: GSTO2 Antibody [NBP3-38184] - Western Blot analysis of various lysates using GSTO2 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Negative control (NC): MOLT-4.Exposure time: 90s.

Immunohistochemistry: GSTO2 Antibody [NBP3-38184] - Immunohistochemistry analysis of GSTO2 in paraffin-embedded Rat testis tissue using GSTO2 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: GSTO2 Antibody [NBP3-38184] - Immunohistochemistry analysis of GSTO2 in paraffin-embedded Mouse testis tissue using GSTO2 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GSTO2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 124-243 of human GSTO2 (NP_899062.1).
  
  Sequence:
  PHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTO2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GSTO2 Antibody - BSA Free

• bA127L20.1 (novel glutathione-S-transferase)
• bA127L20.1
• EC 2.5.1.18
• glutathione S-transferase omega 2
• glutathione S-transferase omega-2
• glutathione-S-transferase-like protein
• GSTO-2

Background

The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1, MIM 180901) (Whitbread et al., 2003 [PubMed 12618591]). For background information on GSTs, see MIM 605482.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSTO2