GSTM3 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Rabbit GSTM3 Antibody - Azide and BSA Free (NBP3-04374) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 101-225 of human GSTM3 (NP_000840.2). VDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GSTM3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for GSTM3 Antibody - Azide and BSA Free
Background
GSTM3, also known as Glutathione S-transferase Mu 3, is a 225 amino acid that is approx. 27 kDa; is responsible for conjugation of reduced glutathione to an extensive number of exogenous and endogenous hydrophobic electrophiles, and may be able to regulate uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers. Current research is being performed on over 70 diseases and disorders including laryngeal squamous cell carcinoma, pharyngitis, laryngitis, squamous cell carcinoma, laryngeal cancer, oral cancer, cataract, colorectal cancer, carcinoma, breast cancer, astrocytoma, non-Hodgkin lymphoma, malignant pleural mesothelioma, open-angle glaucoma, Hodgkin's lymphoma, lung cancer, basal cell carcinoma, adult brain tumor, and leukoplakia. This protein has been shown to have interactions with over 70 proteins including RBL2, GSTM2, PAK2, MPG, and TFE3 in pathways such as glutathione metabolism, metabolism of xenobiotics by cytochrome P450, drug metabolism - cytochrome P450, establishment of blood-nerve barrier, and response to estrogen stimulus pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: BA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for GSTM3 Antibody (NBP3-04374) (0)
There are no publications for GSTM3 Antibody (NBP3-04374).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GSTM3 Antibody (NBP3-04374) (0)
There are no reviews for GSTM3 Antibody (NBP3-04374).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GSTM3 Antibody (NBP3-04374) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GSTM3 Products
Research Areas for GSTM3 Antibody (NBP3-04374)
Find related products by research area.
|
Blogs on GSTM3