GSTM2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GSTM2 Antibody - BSA Free (NBP3-04532) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human GSTM2 (NP_000839.1). MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GSTM2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GSTM2 Antibody - BSA Free
Background
The GSTM2 gene codes for a glutathione S-transferase Mu 2 protein that functions as a catalyst in various reactions in eukaryotes and prokaryotes such as converting reduced gluthathione to a large number of exogenous and endogenous hydrophobic electrophiles. Two isoforms exist: isoform 1 is 218 amino acids long at 25 kDA while isoform 2 is 191 amino acids long at 22 kDA. GSTM2 participates in glutathione methabolism and the metapathway biotransformation and interacts with genes GSTM3, GSTM1, GSTA2, ADH1A, and ITECPR1. GSTM2 has been investigated in its role in carcinoma, hepatitis, arthritis, lung cancer, breast cancer susceptibility, rheumatoid arthritis, and diabetes mellitus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for GSTM2 Antibody (NBP3-04532) (0)
There are no publications for GSTM2 Antibody (NBP3-04532).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GSTM2 Antibody (NBP3-04532) (0)
There are no reviews for GSTM2 Antibody (NBP3-04532).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GSTM2 Antibody (NBP3-04532) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GSTM2 Products
Research Areas for GSTM2 Antibody (NBP3-04532)
Find related products by research area.
|
Blogs on GSTM2