GSTA2 Antibody (3D4)

Images

 
Western Blot: GSTA2 Antibody (3D4) [H00002939-M05] - Analysis of GSTA2 expression in HepG2 (Cat # L019V1).
Immunocytochemistry/ Immunofluorescence: GSTA2 Antibody (3D4) [H00002939-M05] - Analysis of monoclonal antibody to GSTA2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: GSTA2 Antibody (3D4) [H00002939-M05] - Analysis of GSTA2 expression in human liver.
Sandwich ELISA: GSTA2 Antibody (3D4) [H00002939-M05] - Detection limit for recombinant GST tagged GSTA2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSTA2 Antibody (3D4) Summary

Immunogen
GSTA2 (AAH02895, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA
Specificity
GSTA2 - glutathione S-transferase A2 (3D4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and ICC/IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA2 Antibody (3D4)

  • EC 2.5.1.18
  • glutathione S-aralkyltransferase A2
  • glutathione S-aryltransferase A2
  • glutathione S-transferase 2
  • glutathione S-transferase A2
  • glutathione S-transferase alpha 2
  • GST class-alpha member 2
  • GST HA subunit 2
  • GST, class alpha, 2
  • GST2glutathione S-alkyltransferase A2
  • GSTA2-2
  • GST-gamma
  • GTA2
  • GTH2
  • HA subunit 2
  • liver GST2
  • MGC10525
  • S-(hydroxyalkyl)glutathione lyase A2

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-47442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5357
Species: Hu
Applications: WB, IP, Neut
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002939-M05
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GSTA2 Antibody (H00002939-M05) (0)

There are no publications for GSTA2 Antibody (H00002939-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTA2 Antibody (H00002939-M05) (0)

There are no reviews for GSTA2 Antibody (H00002939-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTA2 Antibody (H00002939-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTA2 Products

Bioinformatics Tool for GSTA2 Antibody (H00002939-M05)

Discover related pathways, diseases and genes to GSTA2 Antibody (H00002939-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA2 Antibody (H00002939-M05)

Discover more about diseases related to GSTA2 Antibody (H00002939-M05).
 

Pathways for GSTA2 Antibody (H00002939-M05)

View related products by pathway.

PTMs for GSTA2 Antibody (H00002939-M05)

Learn more about PTMs related to GSTA2 Antibody (H00002939-M05).

Blogs on GSTA2

There are no specific blogs for GSTA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTA2 Antibody (3D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTA2
Entrez
Uniprot