GRTP1 Antibody

Images

 
Immunohistochemistry: GRTP1 Antibody [NBP2-33458] - Staining of stomach.
Immunohistochemistry: GRTP1 Antibody [NBP2-33458] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry: GRTP1 Antibody [NBP2-33458] - Staining of urothelial cancer

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRTP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR
Specificity
Specificity of human GRTP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRTP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRTP1 Protein (NBP2-33458PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRTP1 Antibody

  • FLJ22474
  • growth hormone regulated TBC protein 1
  • growth hormone-regulated TBC protein 1
  • MGC138328
  • TBC1 domain family member 6
  • TBC1 domain family, member 6
  • TBC1D6MGC138330

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37357
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-22471
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-84863
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB100-2527
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NBP2-45844
Species: Hu
Applications: WB, IHC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54654
Species: Hu
Applications: WB, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-37893
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
MAB4640
Species: Hu
Applications: WB

Publications for GRTP1 Antibody (NBP2-33458) (0)

There are no publications for GRTP1 Antibody (NBP2-33458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRTP1 Antibody (NBP2-33458) (0)

There are no reviews for GRTP1 Antibody (NBP2-33458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GRTP1 Antibody (NBP2-33458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRTP1 Products

Array NBP2-33458

Bioinformatics Tool for GRTP1 Antibody (NBP2-33458)

Discover related pathways, diseases and genes to GRTP1 Antibody (NBP2-33458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRTP1 Antibody (NBP2-33458)

Discover more about diseases related to GRTP1 Antibody (NBP2-33458).
 

Pathways for GRTP1 Antibody (NBP2-33458)

View related products by pathway.

Blogs on GRTP1

There are no specific blogs for GRTP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRTP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRTP1
Uniprot