PLBD1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLBD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PLBD1 Antibody - BSA Free
Background
PLBD1, also known as Phospholipase B-like 1, is a 553 amino acid protein that is 63 kDa, cytoplasmic granule subcellular location, commonly found expressed in neutrophils and monocytes; acts on various phospholipids including phosphatidylcholine, phosphatidylinositol, phosphatidylethanolamine, and lysophospholipids; participates in the generation of lipid mediators of inflammation with an important role in defense against invading microorganisms. This protein has been shown to have interactions with SLC747, IGSF6, TYROBP, and GPCDD1 in pathways such as acyl chain remodeling of PE, acyl chain remodelling of PC, hydrolysis of LPC, phospholipid metabolism, acyl chain remodelling of PI, glycerophospholipid biosynthesis, and metabolism of lipids and lipoproteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu
Applications: IHC
Publications for PLBD1 Antibody (NBP2-37893) (0)
There are no publications for PLBD1 Antibody (NBP2-37893).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLBD1 Antibody (NBP2-37893) (0)
There are no reviews for PLBD1 Antibody (NBP2-37893).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PLBD1 Antibody (NBP2-37893) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLBD1 Products
Research Areas for PLBD1 Antibody (NBP2-37893)
Find related products by research area.
|
Blogs on PLBD1