Growth Hormone R Recombinant Protein Antigen

Images

 
There are currently no images for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Growth Hormone R Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Growth Hormone R.

Source: E. coli

Amino Acid Sequence: KEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GHR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55524.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Growth Hormone R Recombinant Protein Antigen

  • GH receptor
  • GHBP
  • GHR
  • growth hormone binding protein
  • Growth Hormone R
  • growth hormone receptor
  • serum binding protein
  • Somatotropin receptor

Background

Growth hormone receptor encodes a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. Other splice variants, including one encoding a soluble form of the protein (GHRtr), have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

291-G1
Species: Hu
Applications: BA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
DGB300
Species: Hu
Applications: ELISA
NBP2-67429
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
292-G2
Species: Hu
Applications: BA
DY871
Species: Hu
Applications: ELISA
MAB2358
Species: Hu, Mu
Applications: ICC, IHC
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
MAB391
Species: Hu, Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Neut, WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-55524PEP
Species: Hu
Applications: AC

Publications for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP) (0)

There are no publications for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP) (0)

There are no reviews for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Growth Hormone R Products

Research Areas for Growth Hormone R Recombinant Protein Antigen (NBP2-55524PEP)

Find related products by research area.

Blogs on Growth Hormone R

There are no specific blogs for Growth Hormone R, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Growth Hormone R Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GHR