| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | GH1 (NP_000506, 1 a.a. - 217 a.a.) full-length human protein. MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
| Specificity | GH1 - growth hormone 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | GH1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Growth Hormone Antibody (H00002688-B01P)Find related products by research area.
|
|
Growth hormone (GH, somatotropin, hGH, pituitary growth hormone) GH is a member of the large family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. Additionally, GH is a 191-amino acid, single-chain polypeptide that is synthesized, stored, and secreted by somatotropic ... Read full blog post. |
|
Somatostatin Receptor 2: Treating Patients Who Cannot Stop Growing Acromegaly is a rare life-shortening disease caused by elevated levels of growth hormone (GH) secreted by a tumor on the pituitary gland. Treatments include somatostatin analogs, which activate somatostatin receptor 2 (SSTR2), reducing GH secretion an... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.