Growth Hormone 2 Antibody - BSA Free

Western Blot: GH2 Antibody [NBP1-59316] - Human Placenta lysate, concentration 5.0ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Growth Hormone 2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GH2(growth hormone 2) The peptide sequence was selected from the middle region of GH2. Peptide sequence NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GH2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Growth Hormone 2 Antibody - BSA Free

• GH2
• GHL
• GHV
• GHVgrowth hormone variant
• GH-VPlacenta-specific growth hormone
• Growth Hormone 2
• growth hormone 2hGH-V
• placental-specific growth hormone

Background

GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GH2
• Uniprot:
  • O14643(Human)