After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
68 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified
Alternate Names for GRHL3 Antibody - BSA Free
grainyhead-like 3 (Drosophila)
MGC46624
Sister of mammalian grainyhead
sister-of-mammalian grainyhead
SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog
TFCP2L4
transcription factor hSOM1
Background
The protein encoded by the GRHL3 gene is part of the grainyhead family of transcription factors and exists in 5 isoforms: isoform 1: 626 AA long, 70 kDA; isoform 2: 607 AA long, 68 kDA; isoform 3: 555 AA long, 62 kDA; isoform 4: 509 AA long; 57 kDA; isoform 5: 602 AA long, 67 kDA. The coded protein works as a transcription factor during development and initiates migration of endothelial cells. GRHL3 frequently interacts with genes GRHL1 and GRHL2. It has been associated with diseases spina bifida, tonsillitis, and prostatitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GRHL3 Antibody - BSA Free and receive a gift card or discount.