GRHL3 Antibody - BSA Free

Western Blot: GRHL3 Antibody [NBP1-80018] - Host: Rabbit. Target Name: GRHL3. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: GRHL3 Antibody [NBP1-80018] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GRHL3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human GRHL3. Peptide sequence SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRHL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GRHL3 Antibody - BSA Free

• grainyhead-like 3 (Drosophila)
• MGC46624
• Sister of mammalian grainyhead
• sister-of-mammalian grainyhead
• SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog
• TFCP2L4
• transcription factor hSOM1

Background

The protein encoded by the GRHL3 gene is part of the grainyhead family of transcription factors and exists in 5 isoforms: isoform 1: 626 AA long, 70 kDA; isoform 2: 607 AA long, 68 kDA; isoform 3: 555 AA long, 62 kDA; isoform 4: 509 AA long; 57 kDA; isoform 5: 602 AA long, 67 kDA. The coded protein works as a transcription factor during development and initiates migration of endothelial cells. GRHL3 frequently interacts with genes GRHL1 and GRHL2. It has been associated with diseases spina bifida, tonsillitis, and prostatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRHL3
• Uniprot:
  • NP_937817(Human)