GRF2 Antibody - BSA Free

Western Blot: GRF2 Antibody [NBP1-88266] - Analysis in control (vector only transfected HEK293T lysate) and RAPGEF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: GRF2 Antibody [NBP1-88266] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: GRF2 Antibody [NBP1-88266] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: GRF2 Antibody [NBP1-88266] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRF2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASK
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAPGEF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GRF2 Protein (NBP1-88266PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GRF2 Antibody - BSA Free

• C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene)
• CRK SH3-binding GNRP
• DKFZp781P1719
• Guanine nucleotide-releasing factor 2
• Protein C3G
• Rap guanine nucleotide exchange factor (GEF) 1
• rap guanine nucleotide exchange factor 1

Background

GRF2 encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRF2 Antibody (NBP1-88266)(1)

Publication using NBP1-88266

• Nayak SC, Radha V C3G localizes to mother centriole dependent on cenexin, and regulates centrosome duplication and primary cilia length J. Cell. Sci. 2020-05-05 [PMID: 32371504]

Bioinformatics

• Gene Symbol: RAPGEF1