Home » Granzyme B » Granzyme B Proteins » Granzyme B Recombinant Protein Antigen

Granzyme B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Granzyme B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GZMB.

Source: E.coli

Amino Acid Sequence: TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GZMB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88151.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Granzyme B Recombinant Protein Antigen

  • C11
  • CCPI
  • CGL1
  • CGL-1
  • CSPB
  • CSP-B
  • CTLA1
  • CTLA-1
  • CTSGL1
  • Fragmentin-2
  • Granzyme B
  • Granzyme-2
  • GranzymeB
  • GRB
  • GrzB
  • GZMB
  • HLP
  • SECT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD8 Antibody
(53-6.7)
NBP1-49045
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(304 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
Granzyme A
Antibody [Unconjugate
AF2905
Granzyme A was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Goat Anti-Human Granzyme A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2905) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Recombinant Human Granzyme A protein was serially diluted 2-fold and captured by Mouse Anti-Human Granzyme A Monoclonal Antibody (Catalog # MAB29052) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human Granzyme A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2905) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Western blot shows lysates of NK‑92 human natural killer lymphoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Granzyme A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2905) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Granzyme A at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, ELISA, ICC
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(19 Reviews)
(337 Publications)
Species: Hu
CD4 Antibody
NBP1-19371
Immunohistochemistry: CD4 Antibody [NBP1-19371] - Increased CD3+ and CD4+ T-cell occurrence in the brainstem of SHR-72 transgenic rat model for tauopathies. (A-D) Immunofluorescence staining showed CD4+ T-cells in SHR-72 transgenic animals. (E- H) Immunofluorescence staining showed more perivascular than brain parenchyma infiltrating CD4+ T-cells in SHR-72 transgenic animals. PLoS One. 2019 May 23;14(5):e0217216. doi: 10.1371/journal.pone.0217216.
Immunohistochemistry: CD4 Antibody [NBP1-19371] - DBZ inhibits the accumulation of CD4+ T cells and Th2 differentiation in the AAAs. (B) The representation of immunohistochemical staining for CD4+ in abdominal aorta from four groups (left). Bar graphs show the percentage of CD4+ positive cell areas (right; n=3 per group). Bar: 50 um.
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
(9 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
TIA1 Antibody
(JM42-11)
NBP2-67203
Western Blot: TIA1 Antibody (JM42-11) [NBP2-67203] - Analysis of TIA1 on Jurkat cells lysates using anti-TIA1 antibody at 1/500 dilution.
Immunocytochemistry/Immunofluorescence: TIA1 Antibody (JM42-11) [NBP2-67203] - Staining TIA1 in Hela cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: TIA1 Antibody (JM42-11) [NBP2-67203] - Analysis of paraffin-embedded human tonsil tissue using anti-TIA1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Fas Ligand/TNFSF6
[Unconjugated]
126-FL
Fas Ligand/TNFSF6 [Unconjugated]
(17 Publications)
Species: Hu
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
NCAM-1/CD56
Antibody (123C3.D5)
NBP2-15184
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)
Flow (Cell Surface): NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - A surface stain was performed on U-87 Cells with NCAM-1/CD56 Antibody (123C3) NBP2-33132B and a matched isotype control. Both antibodies were conjugated to biotin. Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Flow Cytometry: NCAM-1/CD56 Antibody (123C3.D5) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.
(1 Review)
(5 Publications)
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
Fas/TNFRSF6/CD95
[HRP]
DFS00
(17 Publications)
Species: Hu
IL-10 [Biotin]
DY417
(7 Reviews)
(188 Publications)
Species: Mu
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(22 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
SerpinB9 Antibody
NBP2-93879
Western Blot: SerpinB9 Antibody [NBP2-93879] - Analysis of extracts of various cell lines, using SerpinB9 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: SerpinB9 Antibody [NBP2-93879] - Analysis of L929 cells using SerpinB9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: SerpinB9 Antibody [NBP2-93879] - Analysis of C6 cells using SerpinB9 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
IL-15
[Unconjugated]
247-ILB
1 µg/lane of Recombinant Human IL-15 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a major band at 10 kDa.
Recombinant Human IL-15 (Catalog #247-ILB) stimulates cell proliferation in the MO7e human megakaryocytic leukemic cell line. The ED50 for this effect is 0.3-2.6 ng/mL.
(3 Reviews)
(133 Publications)
Species: Hu
Granzyme B
Recombinant Protein A
NBP1-88151PEP
Granzyme B Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP) (0)

There are no publications for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP) (0)

There are no reviews for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional Granzyme B Products

Bioinformatics Tool for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP)

Discover related pathways, diseases and genes to Granzyme B Recombinant Protein Antigen (NBP1-88151PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP)

Discover more about diseases related to Granzyme B Recombinant Protein Antigen (NBP1-88151PEP).
 

Pathways for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP)

View related products by pathway.

PTMs for Granzyme B Recombinant Protein Antigen (NBP1-88151PEP)

Learn more about PTMs related to Granzyme B Recombinant Protein Antigen (NBP1-88151PEP).

Blogs on Granzyme B.

Check out the latest blog posts on Granzyme B.
Caspase 3, the executioner of apoptosis
Caspase-3 enzyme is a member of the family of endoproteases which regulate inflammation and apoptosis signaling networks. Caspase-3 is known as an executioner caspase in apoptosis because of its role in coordinating the destruction of cellular stru...  Read full blog post.
Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include...  Read full blog post.
Caspase 7: The Cell's Suicide Switch
Caspase 7 (also known as CASP7, Mch3, ICE-LAP3, CMH-1) is a member of caspase family of cysteine proteases. It is an apoptosis-related cystein peptidase encoded by the CASP7 gene in humans. CASP7 homologous sequences have been identified in nearly all...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: Granzyme B Antibody [NB100-684] - Staining of Granzyme B in red on FFPE human Tonsil. Secondary antibody is donkey anti-rabbit A647. Nuclei counter-stained with DAPI. Staining pattern is cytoplasmic with obvious polarization (see arrowheads) in some cases. This image was submitted via customer Review.
Granzyme B Antibody
NB100-684
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Granzyme B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GZMB