Granzyme A Antibody - BSA Free

Immunohistochemistry-Paraffin: Granzyme A Antibody [NBP3-17018] - Analysis in human spleen and cerebral cortex tissues using Anti-GZMA antibody. Corresponding GZMA RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Granzyme A Antibody [NBP3-17018] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: Granzyme A Antibody [NBP3-17018] - Staining of human spleen shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Granzyme A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Granzyme A Antibody - BSA Free (NBP3-17018) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GZMA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Granzyme A Antibody - BSA Free

• CTL Tryptase
• CTLA3
• CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease)
• Cytotoxic T-lymphocyte proteinase 1
• EC 3.4.21
• Fragmentin-1
• granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
• Granzyme A
• Granzyme-1
• GZMA
• H factor
• Hanukkah factor
• HF
• HFSP
• HFSPEC 3.4.21.78

Background

The biological function of Granzyme A is unclear. It would appear that the molecule may have a role in the induction of apoptosis via its activity as a serine protease, but this would seem to be subsidiary to the role of Granzyme B. Granzyme A deficient mice are indistinguishable from normal animals in their response to infection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GZMA