GPT Antibody - BSA Free

Western Blot: GPT Antibody [NBP3-38016] - Western blot analysis of various lysates using GPT Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPT Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPT Antibody - BSA Free (NBP3-38016) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GPT (NP_005300.1).
  
  Sequence:
  MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:200 - 1:1000
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPT Antibody - BSA Free

• AAT1alanine aminotransferase 1
• ALT1
• ALT1EC 2.6.1.2
• Glutamate pyruvate transaminase 1
• glutamic-alanine transaminase 1
• Glutamic--alanine transaminase 1
• glutamic-pyruvate transaminase (alanine aminotransferase)
• Glutamic--pyruvic transaminase 1
• GPT1GPT 1

Background

GPT, also known as Alanine aminotransferase 1, is a 496 amino acid that is 55 kDa, cytoplasm located, most commonly found in liver, kidney, heart, and skeletal muscles; acts as a catalyzer of the reversible transamination between alanine and 2-oxoglutarate to compose pyruvate and glutamate, is involved in cellular nitrogen metabolism, and also in liver gluconeogenesis starting with precursors transported from skeletal muscles. Current research is being performed on several diseases and disorders including vitelliform macular dystrophy, liver disease, epidemic typhus, pyomyositis, kidney cortex necrosis, scrub typhus, hepatitis e, hepatitis c, iron overload hepatitis b, glucose intolerance, biliary atresia, alcohol abuse, cholangitis, cholecystitis, hellp syndrome, viral hepatitis, siderosis, choledocholithiasis, hepatitis a, kawasaki disease, wilson disease, and hepatic encephalopathy. This protein has shown to have interactions with CAPN1, CAPN3, HSPD1, THNSL2, GPT2, AND PSAT1 in pathways such as alanine, aspartate and glutamate metabolism, amino acid synthesis and interconversion (transamination), and metabolism of amino acids and derivatives.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPT