GPS2 Antibody (3C4)

Images

 
Western Blot: GPS2 Antibody (3C4) [H00002874-M01] - Analysis of GPS2 expression in transfected 293T cell line by GPS2 monoclonal antibody (M01), clone 3C4.Lane 1: GPS2 transfected lysate (Predicted MW: 36.7 KDa).Lane 2: ...read more
Sandwich ELISA: GPS2 Antibody (3C4) [H00002874-M01] - Detection limit for recombinant GST tagged GPS2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GPS2 Antibody (3C4) Summary

Immunogen
GPS2 (AAH13652 228 a.a. - 327 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Specificity
GPS2 - G protein pathway suppressor 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GPS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002874-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPS2 Antibody (3C4)

  • AMF-1
  • G protein pathway suppressor 2
  • GPS-2
  • MGC104294
  • MGC119287
  • MGC119288
  • MGC119289

Background

This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB100-362
Species: Hu
Applications: WB, IHC-P, PLA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-14457
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NBP1-88822
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00002874-M01
Species: Hu
Applications: WB, ELISA

Publications for GPS2 Antibody (H00002874-M01)(1)

Reviews for GPS2 Antibody (H00002874-M01) (0)

There are no reviews for GPS2 Antibody (H00002874-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPS2 Antibody (H00002874-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPS2 Products

Bioinformatics Tool for GPS2 Antibody (H00002874-M01)

Discover related pathways, diseases and genes to GPS2 Antibody (H00002874-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPS2 Antibody (H00002874-M01)

Discover more about diseases related to GPS2 Antibody (H00002874-M01).
 

Pathways for GPS2 Antibody (H00002874-M01)

View related products by pathway.

PTMs for GPS2 Antibody (H00002874-M01)

Learn more about PTMs related to GPS2 Antibody (H00002874-M01).
 

Research Areas for GPS2 Antibody (H00002874-M01)

Find related products by research area.

Blogs on GPS2

There are no specific blogs for GPS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPS2 Antibody (3C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol GPS2
Entrez
OMIM
Uniprot