GPRIN1 Antibody

Images

 
Western Blot: GPRIN1 Antibody [NBP2-55391] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: GPRIN1 Antibody [NBP2-55391] - Staining of human cell line PC-3 shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPRIN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPRKEEPRYSGKEHPVSSEKVAPT
Specificity
Specificity of human GPRIN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPRIN1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPRIN1 Recombinant Protein Antigen (NBP2-55391PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GPRIN1 Antibody

  • G protein regulated inducer of neurite outgrowth 1
  • GRIN1KIAA1893G protein-regulated inducer of neurite outgrowth 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP2-92892
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-47444
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75597
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NLS1403
Species: Hu
Applications: IHC, IHC-P
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NLS3208
Species: Hu, Po, Bv, Eq, Pm, Pm
Applications: WB, IHC, IHC-P, ICC
36340002
Species: Hu
Applications: WB, ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-94071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-55391
Species: Hu
Applications: WB, ICC/IF

Publications for GPRIN1 Antibody (NBP2-55391) (0)

There are no publications for GPRIN1 Antibody (NBP2-55391).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPRIN1 Antibody (NBP2-55391) (0)

There are no reviews for GPRIN1 Antibody (NBP2-55391). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPRIN1 Antibody (NBP2-55391) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GPRIN1 Products

Bioinformatics Tool for GPRIN1 Antibody (NBP2-55391)

Discover related pathways, diseases and genes to GPRIN1 Antibody (NBP2-55391). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRIN1 Antibody (NBP2-55391)

Discover more about diseases related to GPRIN1 Antibody (NBP2-55391).
 

Pathways for GPRIN1 Antibody (NBP2-55391)

View related products by pathway.

PTMs for GPRIN1 Antibody (NBP2-55391)

Learn more about PTMs related to GPRIN1 Antibody (NBP2-55391).

Blogs on GPRIN1

There are no specific blogs for GPRIN1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPRIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRIN1