GPRC5A/RAI3 Antibody

Images

 
Western Blot: GPRC5A/RAI3 Antibody [H00009052-B01P] - Analysis of GPRC5A expression in human ovarian cancer.
Western Blot: GPRC5A/RAI3 Antibody [H00009052-B01P] - Analysis of GPRC5A expression in transfected 293T cell line by GPRC5A polyclonal antibody. Lane 1: GPRC5A transfected lysate(39.27 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GPRC5A/RAI3 Antibody Summary

Immunogen
GPRC5A (NP_003970.1, 1 a.a. - 357 a.a.) full-length human protein. MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GPRC5A
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPRC5A/RAI3 Antibody

  • G protein-coupled receptor, family C, group 5, member A
  • GPCR5A
  • GPRC5A
  • Orphan G-protein-coupling receptor PEIG-1
  • RAI3
  • RAI3G-protein coupled receptor family C group 5 member A
  • RAIG1
  • RAIG1RAIG-1
  • retinoic acid induced 3
  • retinoic acid responsive
  • Retinoic acid-induced gene 1 protein
  • retinoic acid-induced protein 3

Background

This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-58922
Species: Hu
Applications: WB
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-87160
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS4079
Species: Hu, Ca, Eq, Mk, Pm
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-314
Species: Hu
Applications: WB, IP, PLA
AF6139
Species: Hu
Applications: ICC
H00009052-B01P
Species: Hu
Applications: WB

Publications for GPRC5A/RAI3 Antibody (H00009052-B01P) (0)

There are no publications for GPRC5A/RAI3 Antibody (H00009052-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPRC5A/RAI3 Antibody (H00009052-B01P) (0)

There are no reviews for GPRC5A/RAI3 Antibody (H00009052-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPRC5A/RAI3 Antibody (H00009052-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPRC5A/RAI3 Products

Bioinformatics Tool for GPRC5A/RAI3 Antibody (H00009052-B01P)

Discover related pathways, diseases and genes to GPRC5A/RAI3 Antibody (H00009052-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRC5A/RAI3 Antibody (H00009052-B01P)

Discover more about diseases related to GPRC5A/RAI3 Antibody (H00009052-B01P).
 

Pathways for GPRC5A/RAI3 Antibody (H00009052-B01P)

View related products by pathway.

PTMs for GPRC5A/RAI3 Antibody (H00009052-B01P)

Learn more about PTMs related to GPRC5A/RAI3 Antibody (H00009052-B01P).
 

Research Areas for GPRC5A/RAI3 Antibody (H00009052-B01P)

Find related products by research area.

Blogs on GPRC5A/RAI3

There are no specific blogs for GPRC5A/RAI3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPRC5A/RAI3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRC5A
Entrez
Uniprot