GPR37L1 Recombinant Protein Antigen

Images

 
There are currently no images for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPR37L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR37L1.

Source: E. coli

Amino Acid Sequence: AETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATS

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPR37L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-49419.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR37L1 Recombinant Protein Antigen

  • endothelin B receptor-like protein 2
  • ET(B)R-LP-2
  • ETBRLP2
  • ETBR-LP-2
  • ETBR-LP-2endothelin type b receptor-like protein 2
  • G protein-coupled receptor 37 like 1
  • GPR37L1
  • G-protein coupled receptor 37 like 1
  • G-protein coupled receptor 37-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5579
Species: Hu
Applications: ICC
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB2607
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NLS418
Species: Hu
Applications: IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
MAB4450
Species: Hu
Applications: CyTOF-ready, ICFlow
AF4509
Species: Hu
Applications: WB, ICC
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24640
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-90836PEP
Species: Hu
Applications: AC

Publications for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP) (0)

There are no publications for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP) (0)

There are no reviews for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR37L1 Products

Bioinformatics Tool for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP)

Discover related pathways, diseases and genes to GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP)

Discover more about diseases related to GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP).
 

Pathways for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP)

View related products by pathway.

PTMs for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP)

Learn more about PTMs related to GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP).
 

Research Areas for GPR37L1 Recombinant Protein Antigen (NBP2-49419PEP)

Find related products by research area.

Blogs on GPR37L1

There are no specific blogs for GPR37L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-4 [Unconjugated]
314-BP-010/CF
BMP-4 [Unconjugated]
314-BP-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPR37L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR37L1
Entrez