Recombinant Human GPR37L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GPR37L1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27-130 of Human GPR37L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA

Protein/Peptide Type
Partial Recombinant Protein
Gene
GPR37L1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR37L1 Protein

  • endothelin B receptor-like protein 2
  • ET(B)R-LP-2
  • ETBRLP2
  • ETBR-LP-2
  • ETBR-LP-2endothelin type b receptor-like protein 2
  • G protein-coupled receptor 37 like 1
  • GPR37L1
  • G-protein coupled receptor 37 like 1
  • G-protein coupled receptor 37-like 1

Background

GPR37L1 - G-protein coupled receptor 37 like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB2607
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NLS418
Species: Hu
Applications: IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
MAB4450
Species: Hu
Applications: CyTOF-ready, ICFlow
AF4509
Species: Hu
Applications: WB, ICC
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24640
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-90836PEP
Species: Hu
Applications: AC

Publications for GPR37L1 Partial Recombinant Protein (H00009283-Q01) (0)

There are no publications for GPR37L1 Partial Recombinant Protein (H00009283-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR37L1 Partial Recombinant Protein (H00009283-Q01) (0)

There are no reviews for GPR37L1 Partial Recombinant Protein (H00009283-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR37L1 Partial Recombinant Protein (H00009283-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR37L1 Products

Bioinformatics Tool for GPR37L1 Partial Recombinant Protein (H00009283-Q01)

Discover related pathways, diseases and genes to GPR37L1 Partial Recombinant Protein (H00009283-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR37L1 Partial Recombinant Protein (H00009283-Q01)

Discover more about diseases related to GPR37L1 Partial Recombinant Protein (H00009283-Q01).
 

Pathways for GPR37L1 Partial Recombinant Protein (H00009283-Q01)

View related products by pathway.

PTMs for GPR37L1 Partial Recombinant Protein (H00009283-Q01)

Learn more about PTMs related to GPR37L1 Partial Recombinant Protein (H00009283-Q01).

Blogs on GPR37L1

There are no specific blogs for GPR37L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR37L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR37L1
Entrez