GPR158 Antibody

Images

 
Western Blot: GPR158 Antibody [NBP1-81437] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: GPR158 Antibody [NBP1-81437] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: GPR158 Antibody [NBP1-81437] - Staining of human skeletal muscle shows negative to very weak positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC-P, PAGE
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR158 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQNSNPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVPSESKVQKHVSIVASEMEKNPTFSLKEKSHHKP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR158
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry-Paraffin 1:50-1:200
  • SDS-Page 1:100 - 1:2000
  • Western Blot
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR158 Protein (NBP1-81437PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR158 Antibody

  • G protein-coupled receptor 158
  • GPR158
  • KIAA1136
  • KIAA1136FLJ37801
  • probable G-protein coupled receptor 158
  • RP11-59G22.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NB300-135
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, WB
4575-RS/CF
Species: Hu
Applications: BA
H00004499-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-32356
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00058524-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-32507
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4368
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-37897
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
H00004495-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-74951
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-45863
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-90042
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1160
Species: Bv, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NBP2-37397
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB

Publications for GPR158 Antibody (NBP1-81437) (0)

There are no publications for GPR158 Antibody (NBP1-81437).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR158 Antibody (NBP1-81437) (0)

There are no reviews for GPR158 Antibody (NBP1-81437). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR158 Antibody (NBP1-81437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR158 Products

Bioinformatics Tool for GPR158 Antibody (NBP1-81437)

Discover related pathways, diseases and genes to GPR158 Antibody (NBP1-81437). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR158 Antibody (NBP1-81437)

Discover more about diseases related to GPR158 Antibody (NBP1-81437).
 

Pathways for GPR158 Antibody (NBP1-81437)

View related products by pathway.

PTMs for GPR158 Antibody (NBP1-81437)

Learn more about PTMs related to GPR158 Antibody (NBP1-81437).
 

Research Areas for GPR158 Antibody (NBP1-81437)

Find related products by research area.

Blogs on GPR158

There are no specific blogs for GPR158, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR158 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR158