GPR152 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPR152 Antibody [NBP1-87284] - Staining of human testis shows strong cytoplasmic positivity in subsets of seminiferous duct cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR152 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR152 Antibody - BSA Free (NBP1-87284) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR152
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR152 Protein (NBP1-87284PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPR152 Antibody - BSA Free

• G protein-coupled receptor 152
• G protein-coupled receptor PGR5
• GPR152
• G-protein coupled receptor PGR5
• PGR5
• PGR5MGC148162
• probable G-protein coupled receptor 152

Background

G protein-coupled receptor LS190484 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from a human lung cancer library and from a human normal pooled lung and spleen library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR152