GPR152 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR152 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GPR152 Antibody - BSA Free
Background
G protein-coupled receptor LS190484 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from a human lung cancer library and from a human normal pooled lung and spleen library.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Ca, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bt, Bv, Ca, Ch, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Publications for GPR152 Antibody (NBP1-87284) (0)
There are no publications for GPR152 Antibody (NBP1-87284).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR152 Antibody (NBP1-87284) (0)
There are no reviews for GPR152 Antibody (NBP1-87284).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GPR152 Antibody (NBP1-87284) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR152 Products
Research Areas for GPR152 Antibody (NBP1-87284)
Find related products by research area.
|
Blogs on GPR152