GPR162 Antibody - BSA Free

Western Blot: GPR162 Antibody [NBP2-33740] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: GPR162 Antibody [NBP2-33740] - Staining of human cell line U-2 OS shows localization to microtubule organizing center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GPR162 Antibody [NBP2-33740] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: GPR162 Antibody [NBP2-33740] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: GPR162 Antibody [NBP2-33740] - Staining in human cerebral cortex and pancreas tissues using anti-GPR162 antibody. Corresponding GPR162 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR162 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR162 Antibody - BSA Free (NBP2-33740) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-GPR162 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL
• Predicted Species: Mouse (97%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR162
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GPR162 Recombinant Protein Antigen (NBP2-33740PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GPR162 Antibody - BSA Free

• A-2
• FLJ78837
• G protein-coupled receptor 162
• Gene-rich cluster gene A protein
• GPR162
• GRCA
• GRCAgene rich cluster, A
• probable G-protein coupled receptor 162

Background

GPR162, also known as Probable G-protein coupled receptor 162, has a 588 amino acid long isoform that is 64 kDa and a short 304 amino acid isoform that is 33 kDa, located in the cell membrane, mainly expressed in the brain; acts as an orphan receptor. This protein is being studied for its involvement in St. Louis encephalitis, amyotrophic lateral sclerosis, lymphoma, asphyxia neonatorum, dental caries, spotted fever, typhus, lyme disease, toxic shock syndrome, cystic fibrosis, purpura, pancreatic cancer, and pancreatitis. It has been inferred that GPR162 protein is involved in G-protein coupled receptor signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPR162 Antibody (NBP2-33740)(1)

Publication using NBP2-33740

• Lindqvist A, Abels M, Shcherbina L et al. GPR162 is a beta cell CART receptor iScience 2023-12-01 [PMID: 38077141]

Bioinformatics

• Gene Symbol: GPR162
• Uniprot:
  • Q16538(Human)