GPR10 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GPR10 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRLHR.
  
  

  Source: E. coli

  Amino Acid Sequence: TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PRLHR
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89741.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR10 Recombinant Protein Antigen

• G protein-coupled receptor 10
• GPR10
• GPR10MGC126539
• G-protein coupled receptor 10
• GR3
• hGR3
• MGC126541
• PRLHR
• prolactin releasing hormone receptor
• prolactin releasing peptide receptor
• prolactin-releasing hormone receptor
• prolactin-releasing peptide receptor
• PrRP receptor
• PrRPR

Background

GPR10 (Prolactin releasing hormone receptor/hGR3) is a Releasing Hormone Receptor that controls the secretion of prolactin from the anterior pituitary. Prolactin releasing hormone receptor expression has been documented in human central nervous system (total brain, spinal cord), anterior pituitary, adrenal, cultured placenta decidual cells, and femur, and in rat central nervous system (thalamus, hypothalamus, anterior pituitary), adrenal medulla, testis, and epididymis. An EST has been isolated from a human brain cancer library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRLHR