GPM6A Antibody

Images

 
Western Blot: GPM6A Antibody [NBP2-85000] - Lanes: Lane1: 250ug rat hippocampal culture neurons. Lane2: 200ug rat hippocampal culture neurons. Lane3: 100ug rat hippocampal culture neurons. Lane4: 50ug rat hippocampal ...read more
Immunohistochemistry: GPM6A Antibody [NBP2-85000] - Primary Antibody Dilution: 1:250. Secondary Antibody: Anti-rabbit-AlexaFluor 488. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: GPM6A: Green DAPI: ...read more
Western Blot: GPM6A Antibody [NBP2-85000] - Host: Rabbit. Target Name: GPM6A. Antibody Dilution: 1.0ug/ml. Sample Type: Human brain
Western Blot: GPM6A Antibody [NBP2-85000] - Host: Rabbit. Target: GPM6A. Positive control (+): Human Liver (LI). Negative control (-): Human Stomach Tumor (T-ST). Antibody concentration: 3ug/ml
Western Blot: GPM6A Antibody [NBP2-85000] - Host: Rabbit. Target Name: GPM6A. Sample Tissue: Human Brain. Antibody Dilution: 1ug/ml
Western Blot: GPM6A Antibody [NBP2-85000] - Lanes: Lane1: 400ug rat hippocampal. Lane2: 300ug rat hippocampal. Lane3: 200ug rat hippocampal. Lane4: 100ug rat hippocampal. Primary Antibody Dilution: 1:1000. Secondary ...read more
Immunohistochemistry: GPM6A Antibody [NBP2-85000] - Primary Antibody Dilution: 1:250. Secondary Antibody: Anti-rabbit-AlexaFluor 488. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: GPM6A: Green DAPI: ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPM6A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of GPM6A. Peptide sequence: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GPM6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPM6A Antibody

  • glycoprotein M6A
  • GPM6A
  • M6A
  • M6AGPM6
  • neuronal membrane glycoprotein M6-a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81271
Species: Hu
Applications: Flow, IHC, IHC-P
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-35224
Species: Hu
Applications: Func, PAGE
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-27461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
256-GF/CF
Species: Hu
Applications: BA
NBP2-41194
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00005013-M01
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
H00002019-M04
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB

Publications for GPM6A Antibody (NBP2-85000) (0)

There are no publications for GPM6A Antibody (NBP2-85000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPM6A Antibody (NBP2-85000) (0)

There are no reviews for GPM6A Antibody (NBP2-85000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPM6A Antibody (NBP2-85000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPM6A Products

Bioinformatics Tool for GPM6A Antibody (NBP2-85000)

Discover related pathways, diseases and genes to GPM6A Antibody (NBP2-85000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPM6A Antibody (NBP2-85000)

Discover more about diseases related to GPM6A Antibody (NBP2-85000).
 

Pathways for GPM6A Antibody (NBP2-85000)

View related products by pathway.

PTMs for GPM6A Antibody (NBP2-85000)

Learn more about PTMs related to GPM6A Antibody (NBP2-85000).
 

Research Areas for GPM6A Antibody (NBP2-85000)

Find related products by research area.

Blogs on GPM6A

There are no specific blogs for GPM6A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPM6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPM6A