GPKOW Antibody - BSA Free

Western Blot: GPKOW Antibody [NBP1-81801] - Analysis using Anti-GPKOW antibody NBP1-81801 (A) shows similar pattern to independent antibody NBP1-81800 (B).

Immunocytochemistry/Immunofluorescence: GPKOW Antibody [NBP1-81801] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human pancreas using Anti-GPKOW antibody NBP1-81801.

Western Blot: GPKOW Antibody [NBP1-81801] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human fallopian tube shows nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human cerebral cortex, colon, kidney and pancreas using Anti-GPKOW antibody NBP1-81801 (A) shows similar protein distribution across tissues to independent antibody NBP1-81800 (B).

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons and i glial cells.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human pancreas shows moderate to strong nuclear positivity in exocrine glandular cells and in islets of Langerhans.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules and in cells in glomeruli.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human cerebral cortex using Anti-GPKOW antibody NBP1-81801.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human colon using Anti-GPKOW antibody NBP1-81801.

Immunohistochemistry-Paraffin: GPKOW Antibody [NBP1-81801] - Staining of human kidney using Anti-GPKOW antibody NBP1-81801.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPKOW Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA
• Marker: Nucleus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPKOW
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GPKOW Protein (NBP1-81801PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPKOW Antibody - BSA Free

• G patch domain and KOW motifs
• GPATC5G patch domain and KOW motifs-containing protein
• GPATCH5G patch domain-containing protein 5
• Protein MOS2 homolog
• Spp2
• T54Protein T54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPKOW Antibody (NBP1-81801)(1)

Publication using NBP1-81801

• Aksaas AK, Larsen AC, Rogne M et al. G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A. J Mol Signal 2011-08-31 [PMID: 21880142]

Bioinformatics

• Gene Symbol: GPKOW