GPIHBP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GPIHBP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPIHBP1.
  
  

  Source: E. coli

  Amino Acid Sequence: CYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GPIHBP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47445.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPIHBP1 Recombinant Protein Antigen

• glycosylphosphatidylinositol anchored high density lipoprotein binding protein1
• glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein1
• GPI anchored high density lipoprotein binding protein 1
• GPI-Anchored HDL-Binding Protein 1
• GPIHBP1
• GPI-HBP1
• GPI-HBP1LOC338328
• HBP1
• High density lipoprotein-binding protein 1
• HYPL1D

Background

GPIHBP1 is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel where they are hydrolyzed by the enzyme lipoprotein lipase (LpL). Gpihbp1 is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of GPIHBP1.

GPIHBP1 antibodies are useful tools for lipid and fat metabolism research, obesity studies and specifically chylomicron transport and regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GPIHBP1