GPIHBP1 Antibody

Immunohistochemistry-Paraffin: GPIHBP1 Antibody [NBP2-47445] - Staining in human breast and colon tissues using anti-GPIHBP1 antibody. Corresponding GPIHBP1 RNA-seq data are presented for the same tissues.

Western Blot: GPIHBP1 Antibody [NBP2-47445] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251 MG. Lane 4: Human plasma. Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: GPIHBP1 Antibody [NBP2-47445] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: GPIHBP1 Antibody [NBP2-47445] - Staining of human breast shows moderate cytoplasmic positivity in adipocytes.

Product Discontinued

GPIHBP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPIHBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPIHBP1 Protein (NBP2-47445PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPIHBP1 Antibody

• glycosylphosphatidylinositol anchored high density lipoprotein binding protein1
• glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein1
• GPI anchored high density lipoprotein binding protein 1
• GPI-Anchored HDL-Binding Protein 1
• GPIHBP1
• GPI-HBP1
• GPI-HBP1LOC338328
• HBP1
• High density lipoprotein-binding protein 1
• HYPL1D

Background

GPIHBP1 is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel where they are hydrolyzed by the enzyme lipoprotein lipase (LpL). Gpihbp1 is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of GPIHBP1.

GPIHBP1 antibodies are useful tools for lipid and fat metabolism research, obesity studies and specifically chylomicron transport and regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPIHBP1