GPIHBP1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: CYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPIHBP1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for GPIHBP1 Antibody
Background
GPIHBP1 is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel where they are hydrolyzed by the enzyme lipoprotein lipase (LpL). Gpihbp1 is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of GPIHBP1.
GPIHBP1 antibodies are useful tools for lipid and fat metabolism research, obesity studies and specifically chylomicron transport and regulation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, IHC
Publications for GPIHBP1 Antibody (NBP2-47445) (0)
There are no publications for GPIHBP1 Antibody (NBP2-47445).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPIHBP1 Antibody (NBP2-47445) (0)
There are no reviews for GPIHBP1 Antibody (NBP2-47445).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPIHBP1 Antibody (NBP2-47445) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPIHBP1 Products
Research Areas for GPIHBP1 Antibody (NBP2-47445)
Find related products by research area.
|
Blogs on GPIHBP1