We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GOLM1 Recombinant Protein Antigen

Images

 
There are currently no images for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GOLM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLM1.

Source: E. coli

Amino Acid Sequence: GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOLM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88775.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GOLM1 Recombinant Protein Antigen

  • bA379P1.3
  • FLJ23608
  • golgi membrane protein 1
  • Golgi membrane protein GP73
  • Golgi phosphoprotein 2C9orf155
  • golgi protein, 73-kD
  • GOLPH2 FLJ22634
  • GP73 chromosome 9 open reading frame 155
  • GP73
  • PSEC0257

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by GOLM1 is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of GOLM1 has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for GOLM1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF,  IHC-P, WB
NBP1-83910
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-87168
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF7355
Species: Hu
Applications: ICC, Simple Western, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP1-88775PEP
Species: Hu
Applications: AC

Publications for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP) (0)

There are no publications for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP) (0)

There are no reviews for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GOLM1 Products

Research Areas for GOLM1 Recombinant Protein Antigen (NBP1-88775PEP)

Find related products by research area.

Blogs on GOLM1

There are no specific blogs for GOLM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GOLM1 Antibody
NBP1-50627

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GOLM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLM1