GOLM1 Antibody (5B10) - Azide and BSA Free Summary
| Immunogen |
GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
| Specificity |
GOLPH2 - golgi phosphoprotein 2 (5B10) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GOLM1 |
| Purity |
Ascites |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Ascites |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GOLM1 Antibody (5B10) - Azide and BSA Free
Background
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Publications for GOLM1 Antibody (H00051280-M06)(6)
Showing Publications 1 -
6 of 6.
| Publications using H00051280-M06 |
Applications |
Species |
| Liewen H, Markuly N, Laubli H et al. Therapeutic Targeting of Golgi Phosphoprotein 2 (GOLPH2) with Armed Antibodies: A Preclinical Study of Anti-GOLPH2 Antibody Drug Conjugates in Lung and Colorectal Cancer Models of Patient Derived Xenografts (PDX). Target Oncol. 2019-10-15 [PMID: 31541350] |
|
|
| Hirst J, Itzhak D, Antrobus R et al. Role of the AP-5 adaptor protein complex in late endosome-to-Golgi retrieval. PLoS Biol. 2018-01-15 [PMID: 29381698] |
|
|
| Braun M, Menon R, Nikolov P et al. The HOPE fixation technique - a promising alternative to common prostate cancer biobanking approaches. BMC Cancer. 2011-12-07 [PMID: 22151117] |
|
|
| Scheble VJ, Braun M, Wilbertz T et al. ERG rearrangement in small cell prostatic and lung cancer. Histopathology. 2010-01-10 [PMID: 20636794] |
|
|
| Kristiansen G, Fritzsche FR, Wassermann K et al. GOLPH2 protein expression as a novel tissue biomarker for prostate cancer: implications for tissue-based diagnostics. Br J Cancer. 2008-09-16 [PMID: 18781151] |
|
|
| Wei S, Dunn TA, Isaacs WB et al. GOLPH2 and MYO6: putative prostate cancer markers localized to the Golgi apparatus. Prostate. 2008-09-15 [PMID: 18543251] |
|
|
Reviews for GOLM1 Antibody (H00051280-M06) (0)
There are no reviews for GOLM1 Antibody (H00051280-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GOLM1 Antibody (H00051280-M06) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GOLM1 Products
Research Areas for GOLM1 Antibody (H00051280-M06)
Find related products by research area.
|
Blogs on GOLM1