GOLM1 Antibody (5B10)

Images

 
Western Blot: GOLM1 Antibody (5B10) [H00051280-M06] - Analysis of GOLM1 expression in transfected 293T cell line by GOLM1 monoclonal antibody (M06), clone 5B10. Lane 1: GOLM1 transfected lysatE (45.3 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: GOLM1 Antibody (5B10) [H00051280-M06] - Analysis of monoclonal antibody to GOLM1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: GOLM1 Antibody (5B10) [H00051280-M06] - Analysis of monoclonal antibody to GOLM1 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 3 ug/ml
ELISA: GOLM1 Antibody (5B10) [H00051280-M06] - Detection limit for recombinant GST tagged GOLPH2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
5B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GOLM1 Antibody (5B10) Summary

Immunogen
GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
Specificity
GOLPH2 - golgi phosphoprotein 2 (5B10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GOLM1
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using H00051280-M06.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GOLM1 Antibody (5B10)

  • bA379P1.3
  • FLJ23608
  • golgi membrane protein 1
  • Golgi membrane protein GP73
  • Golgi phosphoprotein 2C9orf155
  • golgi protein, 73-kD
  • GOLPH2 FLJ22634
  • GP73 chromosome 9 open reading frame 155
  • GP73
  • PSEC0257

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes protein synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this encoded protein has been observed to be upregulated in response to viral infection. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP2-58286
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47594
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-87168
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, KO, Simple Western, WB
DCLU00
Species: Hu
Applications: ELISA
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
H00051280-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for GOLM1 Antibody (H00051280-M06)(4)

Reviews for GOLM1 Antibody (H00051280-M06) (0)

There are no reviews for GOLM1 Antibody (H00051280-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GOLM1 Antibody (H00051280-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GOLM1 Products

Bioinformatics Tool for GOLM1 Antibody (H00051280-M06)

Discover related pathways, diseases and genes to GOLM1 Antibody (H00051280-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLM1 Antibody (H00051280-M06)

Discover more about diseases related to GOLM1 Antibody (H00051280-M06).
 

Pathways for GOLM1 Antibody (H00051280-M06)

View related products by pathway.

PTMs for GOLM1 Antibody (H00051280-M06)

Learn more about PTMs related to GOLM1 Antibody (H00051280-M06).
 

Research Areas for GOLM1 Antibody (H00051280-M06)

Find related products by research area.

Blogs on GOLM1

There are no specific blogs for GOLM1, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GOLM1 Antibody (5B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLM1
OMIM