GO Protein alpha Antibody - BSA Free

Immunohistochemistry: GO Protein alpha Antibody [NBP3-09336] - Immunohistochemical analysis of cerebellum tissue at an antibody concentration of 5ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GO Protein alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GO Protein alpha Antibody - BSA Free (NBP3-09336) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GO Protein alpha (NP_620073). Peptide sequence CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNAO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GO Protein alpha Antibody - BSA Free

• DKFZp686O0962
• G-ALPHA-o
• GNAO
• guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O
• guanine nucleotide binding protein, alpha activating polypeptide O
• guanine nucleotide-binding protein G(o) subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNAO1