GO Protein alpha Antibody

Images

 
Western Blot: GO Protein alpha Antibody [H00002775-B01P] - Analysis of GNAO1 expression in transfected 293T cell line by GNAO1 polyclonal antibody. Lane 1: GNAO1 transfected lysate(34.60 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GO Protein alpha Antibody Summary

Immunogen
GNAO1 (AAH30027.2, 1 a.a. - 302 a.a.) full-length human protein. MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
Specificity
Reacts with guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GNAO1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GO Protein alpha Antibody

  • DKFZp686O0962
  • G-ALPHA-o
  • GNAO
  • guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide O
  • guanine nucleotide binding protein, alpha activating polypeptide O
  • guanine nucleotide-binding protein G(o) subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89515
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-30869
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88212
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NLS272
Species: Hu, Mu, Rt, Ha, Mk, Rb
Applications: IHC-P
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-36746
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-60120
Species: Hu
Applications: WB, TCS

Publications for GO Protein alpha Antibody (H00002775-B01P) (0)

There are no publications for GO Protein alpha Antibody (H00002775-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GO Protein alpha Antibody (H00002775-B01P) (0)

There are no reviews for GO Protein alpha Antibody (H00002775-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GO Protein alpha Antibody (H00002775-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GO Protein alpha Products

Bioinformatics Tool for GO Protein alpha Antibody (H00002775-B01P)

Discover related pathways, diseases and genes to GO Protein alpha Antibody (H00002775-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GO Protein alpha Antibody (H00002775-B01P)

Discover more about diseases related to GO Protein alpha Antibody (H00002775-B01P).
 

Pathways for GO Protein alpha Antibody (H00002775-B01P)

View related products by pathway.

PTMs for GO Protein alpha Antibody (H00002775-B01P)

Learn more about PTMs related to GO Protein alpha Antibody (H00002775-B01P).
 

Research Areas for GO Protein alpha Antibody (H00002775-B01P)

Find related products by research area.

Blogs on GO Protein alpha

There are no specific blogs for GO Protein alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GO Protein alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNAO1
Entrez
Uniprot