![Western Blot: GO Protein alpha Antibody [H00002775-B01P] - Analysis of GNAO1 expression in transfected 293T cell line by GNAO1 polyclonal antibody. Lane 1: GNAO1 transfected lysate(34.60 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/GO-Protein-alpha-Antibody-Western-Blot-H00002775-B01P-img0002.jpg "Western Blot: GO Protein alpha Antibody [H00002775-B01P] - Analysis of GNAO1 expression in transfected 293T cell line by GNAO1 polyclonal antibody. Lane 1: GNAO1 transfected lysate(34.60 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | GNAO1 (AAH30027.2, 1 a.a. - 302 a.a.) full-length human protein. MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY |
| Specificity | Reacts with guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | GNAO1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GO Protein alpha Antibody (H00002775-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GNAO1 |
| Entrez |
|
| Uniprot |
|
![Western Blot TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TBX3_AF4509_Western_Blot_5482.jpg)
![Immunocytochemistry TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TBX3_AF4509_Immunocytochemistry__Immunofluorescence_23053.jpg)
![Western Blot TBX3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4509_human-tbx3-affinity-purified-polyclonal-ab-western-blot-1182021152353.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![BMPR-IB/ALK-6 Antibody (88614) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "BMPR-IB/ALK-6 Antibody (88614) [Unconjugated]")
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")