GNRHR2 Antibody (4A5)

Images

 
Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5. Analysis of GNRHR2 expression in Raw 264.7.
Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5 Analysis of GNRHR2 expression in HeLa.
Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5. Analysis of GNRHR2 expression in HepG2.
Western Blot: GNRHR2 Antibody (4A5) [H00114814-M01] - GNRHR2 monoclonal antibody (M01), clone 4A5. Analysis of GNRHR2 expression in NIH/3T3.
Sandwich ELISA: GNRHR2 Antibody (4A5) [H00114814-M01] - Detection limit for recombinant GST tagged GNRHR2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GNRHR2 Antibody (4A5) Summary

Immunogen
GNRHR2 (NP_001457, 237 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Specificity
GNRHR2 - gonadotropin-releasing hormone (type 2) receptor 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GNRHR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNRHR2 Antibody (4A5)

  • AC4
  • adenylate cyclase 4
  • adenylate cyclase type 4
  • Adenylate cyclase type IV
  • Adenylyl cyclase 4
  • ATP pyrophosphate-lyase 4
  • EC 4.6.1
  • EC 4.6.1.1

Background

The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45298
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP1-86515
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-56708
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-506
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DFS00
Species: Hu
Applications: ELISA
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
236-EG
Species: Hu
Applications: BA
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP1-32252
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00114814-M01
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Publications for GNRHR2 Antibody (H00114814-M01) (0)

There are no publications for GNRHR2 Antibody (H00114814-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNRHR2 Antibody (H00114814-M01) (0)

There are no reviews for GNRHR2 Antibody (H00114814-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNRHR2 Antibody (H00114814-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNRHR2 Products

Array H00114814-M01

Bioinformatics Tool for GNRHR2 Antibody (H00114814-M01)

Discover related pathways, diseases and genes to GNRHR2 Antibody (H00114814-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNRHR2 Antibody (H00114814-M01)

Discover more about diseases related to GNRHR2 Antibody (H00114814-M01).
 

Pathways for GNRHR2 Antibody (H00114814-M01)

View related products by pathway.

PTMs for GNRHR2 Antibody (H00114814-M01)

Learn more about PTMs related to GNRHR2 Antibody (H00114814-M01).

Blogs on GNRHR2

There are no specific blogs for GNRHR2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNRHR2 Antibody (4A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GNRHR2
Entrez