GNPTG Antibody - Azide and BSA Free

Western Blot: GNPTG Antibody [H00084572-B01P] - Analysis of GNPTG expression in transfected 293T cell line by GNPTG polyclonal antibody. Lane 1: GNPTG transfected lysate(33.55 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GNPTG Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse GNPTG Antibody - Azide and BSA Free (H00084572-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: GNPTG (AAH14592, 19 a.a. - 304 a.a.) full-length human protein. PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL
• Specificity: GNPTG - N-acetylglucosamine-1-phosphate transferase, gamma subunit,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GNPTG
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNPTG Antibody - Azide and BSA Free

• C16orf27
• c316G12.3
• CAB56184
• GlcNAc-1-phosphotransferase subunit gamma
• GNPTAGchromosome 16 open reading frame 27
• LP2537
• N-acetylglucosamine-1-phosphate transferase, gamma subunit
• N-acetylglucosamine-1-phosphotransferase subunit gamma
• N-acetylglucosamine-1-phosphotransferase, gamma subunit
• RJD9
• UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma

Background

UDP-N-acetylglucosamine:lysosomal-enzyme N-acetylglucosamine-1-phosphotransferase (GlcNAc-phosphotransferase) catalyzes the initial step in the synthesis of the mannose 6-phosphate determinant required for efficient intracellular targeting of newly synthesized lysosomal hydrolases to the lysosome. GlcNAc-phosphotransferase is an alpha-2/beta-2/gamma-2 hexameric complex, the enzyme product of 2 genes, 1 encoded by a gene on chromosome 16 (GNPTG) and the other by a gene on chromosome 12 (GNPTAB; MIM 607840).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNPTG
• Entrez:
  • 84572(Human)
• Uniprot:
  • AAH14592(Human)